PDB entry 6hpj

View 6hpj on RCSB PDB site
Description: structure of human srsf1 rrm1 bound to aacaaa rna
Deposited on 2018-09-21, released 2020-11-18
The last revision was dated 2021-06-02, with a file datestamp of 2021-05-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA (5'-r(*ap*ap*cp*ap*ap*a)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'B':
    Compound: Immunoglobulin G-binding protein G,Serine/arginine-rich splicing factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SRSF1, ASF, SF2, SF2P33, SFRS1, OK/SW-cl.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909
    • Uniprot Q07955
      • conflict (100)
      • conflict (135)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hpjB (B:)
mqyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvtegshh
hhhhmsgggvirgpagnndcriyvgnlppdirtkdiedvfskygairdidlknrrggppf
afvefedprdaedavsgrdgydydgyrlrvefprsgrgtgr

    Sequence, based on observed residues (ATOM records):
    >6hpjB (B:)
virgpagnndcriyvgnlppdirtkdiedvfskygairdidlknrrggppfafvefedpr
daedavsgrdgydydgyrlrvefp