PDB entry 6hpg

View 6hpg on RCSB PDB site
Description: Arabidopsis OM64 TPR domain
Class: plant protein
Keywords: Tetratrico-peptide-repeat, Mitochondria, protein import, Arabodopsis thaliana, PLANT PROTEIN
Deposited on 2018-09-20, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer envelope protein 64, mitochondrial
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: OM64, TOC64-V, At5g09420, T5E8.220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hpga_
  • Chain 'B':
    Compound: Outer envelope protein 64, mitochondrial
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: OM64, TOC64-V, At5g09420, T5E8.220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hpgb_
  • Chain 'C':
    Compound: Outer envelope protein 64, mitochondrial
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: OM64, TOC64-V, At5g09420, T5E8.220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hpgc_
  • Chain 'D':
    Compound: Outer envelope protein 64, mitochondrial
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: OM64, TOC64-V, At5g09420, T5E8.220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hpgd_
  • Chain 'E':
    Compound: Outer envelope protein 64, mitochondrial
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: OM64, TOC64-V, At5g09420, T5E8.220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hpge_
  • Chain 'F':
    Compound: Outer envelope protein 64, mitochondrial
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: OM64, TOC64-V, At5g09420, T5E8.220
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hpgf_
  • Chain 'a':
    Compound: Heat shock protein 90-4
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HSP90-4, HSP81-4, At5g56000, MDA7.4
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Heat shock protein 90-4
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HSP90-4, HSP81-4, At5g56000, MDA7.4
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Heat shock protein 90-4
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HSP90-4, HSP81-4, At5g56000, MDA7.4
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Heat shock protein 90-4
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HSP90-4, HSP81-4, At5g56000, MDA7.4
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Heat shock protein 90-4
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HSP90-4, HSP81-4, At5g56000, MDA7.4
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: Heat shock protein 90-4
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HSP90-4, HSP81-4, At5g56000, MDA7.4
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hpgA (A:)
    gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae
    qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrlrkh
    i
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hpgB (B:)
    gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae
    qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrlrkh
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hpgB (B:)
    gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae
    qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hpgC (C:)
    gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae
    qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrlrkh
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hpgC (C:)
    gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae
    qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hpgD (D:)
    gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae
    qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrlrkh
    i
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6hpgE (E:)
    gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae
    qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrlrkh
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hpgE (E:)
    gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae
    qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6hpgF (F:)
    gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae
    qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrlrkh
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hpgF (F:)
    gnmeasevmkekgnaaykgkqwnkavnfyteaiklnganatyycnraaaflelccfqqae
    qdctkamlidkknvkaylrrgtareslvrykeaaadfrhalvlepqnktakvaekrl
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.