PDB entry 6hpc

View 6hpc on RCSB PDB site
Description: crystal structure of the hicb antitoxin from e. coli
Deposited on 2018-09-20, released 2019-09-18
The last revision was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antitoxin HicB
    Species: Escherichia coli 2-210-07_S3_C3 [TaxId:1444180]
    Gene: hicB, AC45_3823
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: antitoxin HicB
    Species: Escherichia coli 2-210-07_S3_C3 [TaxId:1444180]
    Gene: hicB, AC45_3823
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6hpcA (A:)
mrypvtltpapeggymvsfvdipealtqgetvaeameaakdalltafdfyfedneliplp
splnshdhfievplsvaskvlllnaflqseitqqelarrigkpkqeitrlfnlhhatkid
avqlaakalgkelslvmv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6hpcB (B:)
mrypvtltpapeggymvsfvdipealtqgetvaeameaakdalltafdfyfedneliplp
splnshdhfievplsvaskvlllnaflqseitqqelarrigkpkqeitrlfnlhhatkid
avqlaakalgkelslvmv