PDB entry 6hpa

View 6hpa on RCSB PDB site
Description: crystal structure of a ba3943 mutant,a ce4 family pseudoenzyme
Deposited on 2018-09-20, released 2019-10-09
The last revision was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative polysaccharide deacetylase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: ylxY, BA_3943, A9486_19545, BASH2_01993, CN272_11110, COL95_11150
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Q4M7R6 (0-272)
      • engineered mutation (92)
  • Heterogens: SO4, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6hpaA (A:)
qdnlyeeiqkhakqyeiapqnamidkiwkatpgyngrqvdmeasynnmkklkkfdqkhle
fkevspsvhledlspapiyrghpnkkmvgltidvawgneylprileilkkhdvkatffle
grwvkenlrfakmivdanqevgnhsythpnmktlssdeirdqlqktnrmieaatnqkvrw
fappsgsfrdevvkiaddfqmgtimwtvdtidwkrpepdvllqrvmrkihpgaivlmhpt
ssttealdtmitklkeqgykvgnitelldekrv