PDB entry 6hp9

View 6hp9 on RCSB PDB site
Description: Structure of the kinase domain of human DDR1 in complex with a 2-Amino-2,3-Dihydro-1H-Indene-5-Carboxamide-based inhibitor
Class: transferase
Keywords: DDR1, Structural Genomics, Structural Genomics Consortium, SGC, transferase
Deposited on 2018-09-19, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epithelial discoidin domain-containing receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR1, CAK, EDDR1, NEP, NTRK4, PTK3A, RTK6, TRKE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08345 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6hp9a1, d6hp9a2
  • Chain 'B':
    Compound: epithelial discoidin domain-containing receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR1, CAK, EDDR1, NEP, NTRK4, PTK3A, RTK6, TRKE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hp9b_
  • Heterogens: GKB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hp9A (A:)
    smprvdfprsrlrfkeklgegqfgevhlcevdspqdlvsldfplnvrkghpllvavkilr
    pdatknarndflkevkimsrlkdpniirllgvcvqddplcmitdymengdlnqflsahql
    edkaaegapgdgqaaqgptisypmllhvaaqiasgmrylatlnfvhrdlatrnclvgenf
    tikiadfgmsrnlyagdyyrvqgravlpirwmawecilmgkfttasdvwafgvtlwevlm
    lcraqpfgqltdeqvienageffrdqgrqvylsrppacpqglyelmlrcwsreseqrppf
    sqlhrflaedalntv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hp9A (A:)
    smprvdfprsrlrfkeklgegqfgevhlcevdspqdlvsldfplnvrkghpllvavkilr
    pdatknarndflkevkimsrlkdpniirllgvcvqddplcmitdymengdlnqflsahql
    eqgptisypmllhvaaqiasgmrylatlnfvhrdlatrnclvgenftikiadfgmsrnly
    agdyyrvqgravlpirwmawecilmgkfttasdvwafgvtlwevlmlcraqpfgqltdeq
    vienageffrdqgrqvylsrppacpqglyelmlrcwsreseqrppfsqlhrflaeda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hp9B (B:)
    smprvdfprsrlrfkeklgegqfgevhlcevdspqdlvsldfplnvrkghpllvavkilr
    pdatknarndflkevkimsrlkdpniirllgvcvqddplcmitdymengdlnqflsahql
    edkaaegapgdgqaaqgptisypmllhvaaqiasgmrylatlnfvhrdlatrnclvgenf
    tikiadfgmsrnlyagdyyrvqgravlpirwmawecilmgkfttasdvwafgvtlwevlm
    lcraqpfgqltdeqvienageffrdqgrqvylsrppacpqglyelmlrcwsreseqrppf
    sqlhrflaedalntv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hp9B (B:)
    vdfprsrlrfkeklgegqfgevhlcevdspqdlhpllvavkilrpdatknarndflkevk
    imsrlkdpniirllgvcvqddplcmitdymengdlnqflsahqledgptisypmllhvaa
    qiasgmrylatlnfvhrdlatrnclvgenftikiadfgmsrnlyagdyyrvqgravlpir
    wmawecilmgkfttasdvwafgvtlwevlmlcraqpfgqltdeqvienageffrdqgrqv
    ylsrppacpqglyelmlrcwsreseqrppfsqlhrflaeda