PDB entry 6hos

View 6hos on RCSB PDB site
Description: Structure of the KpFlo2 adhesin domain in complex with glycerol
Class: cell adhesion
Keywords: C-type lectin, Komagataella pastoris, cell surface, CELL ADHESION
Deposited on 2018-09-18, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ba75_04148t0
    Species: Komagataella pastoris [TaxId:4922]
    Gene: ATY40_BA7504148
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hosa_
  • Chain 'B':
    Compound: ba75_04148t0
    Species: Komagataella pastoris [TaxId:4922]
    Gene: ATY40_BA7504148
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hosb_
  • Chain 'C':
    Compound: Expression tag from chain B, or symmetry related chain
    Species: Komagataella pastoris [TaxId:4922]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HOS (0-10)
  • Heterogens: CA, GOL, P33, MG, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hosA (A:)
    mgsshhhhhhssglvprgshmqesgdgdisdsayacdidatrydgfnatiyefqpgdgrl
    trdpvfmstgylnrtqlhsitgvtdpgfsiytpgvptttlygipnvnwenlllelkgyfr
    aevsgdyglslrniddsailffgketafqccnensisneastdyslftifrqegdettnl
    dsftytqyleagkyypvrtffvnierhavfnftmtlpdgteltdfhnyiyqfgaldeeqc
    qa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hosA (A:)
    sdsayacdidatrydgfnatiyefqpgdgrltrdpvfmstgylnrtqlhsitgvtdpgfs
    iytpgvptttlygipnvnwenlllelkgyfraevsgdyglslrniddsailffgketafq
    ccnensisneastdyslftifrqegdettnldsftytqyleagkyypvrtffvnierhav
    fnftmtlpdgteltdfhnyiyqfgaldeeqcqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hosB (B:)
    mgsshhhhhhssglvprgshmqesgdgdisdsayacdidatrydgfnatiyefqpgdgrl
    trdpvfmstgylnrtqlhsitgvtdpgfsiytpgvptttlygipnvnwenlllelkgyfr
    aevsgdyglslrniddsailffgketafqccnensisneastdyslftifrqegdettnl
    dsftytqyleagkyypvrtffvnierhavfnftmtlpdgteltdfhnyiyqfgaldeeqc
    qa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hosB (B:)
    sayacdidatrydgfnatiyefqpgdgrltrdpvfmstgylnrtqlhsitgvtdpgfsiy
    tpgvptttlygipnvnwenlllelkgyfraevsgdyglslrniddsailffgketafqcc
    nensisneastdyslftifrqegdettnldsftytqyleagkyypvrtffvnierhavfn
    ftmtlpdgteltdfhnyiyqfgaldeeqcqa
    

  • Chain 'C':
    No sequence available.