PDB entry 6hok

View 6hok on RCSB PDB site
Description: Structure of Beclin1 LIR (S96E) motif bound to GABARAP
Class: signaling protein
Keywords: Autophagy, ATG8, LIR, SIGNALING PROTEIN
Deposited on 2018-09-17, released 2019-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beclin-1,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14457 (0-12)
      • engineered mutation (3)
      • linker (13-14)
    • Uniprot O95166 (15-126)
    Domains in SCOPe 2.08: d6hoka_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hokA (A:)
    saneftligeasdgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdld
    kkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedffl
    yiaysde