PDB entry 6hog

View 6hog on RCSB PDB site
Description: Structure of VPS34 LIR motif bound to GABARAP
Class: signaling protein
Keywords: Autophagy, ATG8, LIR, SIGNALING PROTEIN
Deposited on 2018-09-17, released 2019-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3-kinase catalytic subunit type 3,Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hoga_
  • Heterogens: SO4, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6hogA (A:)
spiltsfelvkvpdpgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigd
ldkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedf
flyiaysde

    Sequence, based on observed residues (ATOM records): (download) 
    >6hogA (A:)
ltsfelvkvgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkky
lvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiay
sde