PDB entry 6ho0

View 6ho0 on RCSB PDB site
Description: transcriptional repressor ethr from mycobacterium tuberculosis in complex with bdm41325
Class: DNA binding protein
Keywords: helix-turn-helix, DNA binding protein, tetr-family, complex, inhibitor, drug design, tuberculosis, ethionamide
Deposited on 2018-09-17, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator EthR
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: ethR, etaR, Rv3855
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ho0a1, d6ho0a2
  • Heterogens: GFK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ho0A (A:)
    mttsaasqaslpmttsaasqaslprgrrtarpsgddrelailataenlledrpladisvd
    dlakgagisrptfyfyfpskeavlltlldrvvnqadmalqtlaenpadtdrenmwrtgin
    vffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavidaerdrgaaprtlpa
    helatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiygenr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ho0A (A:)
    drelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvnqa
    dmalqtlaendrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwia
    ytaavidaerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiw
    vtsiyge