PDB entry 6hnr

View 6hnr on RCSB PDB site
Description: Trypanosoma brucei PTR1 in complex with the triazine inhibitor 1 (F217)
Class: oxidoreductase
Keywords: Trypanosoma brucei, pteridine reductase, PTR1, TbPTR1, triazine inhibitors, OXIDOREDUCTASE
Deposited on 2018-09-17, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnra_
  • Chain 'B':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnrb_
  • Chain 'C':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnrc_
  • Chain 'D':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: PTR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnrd_
  • Heterogens: NAP, GFE, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hnrA (A:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnrA (A:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hnrB (B:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnrB (B:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvktvetqvaeligtnaiap
    flltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvn
    gvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvd
    gglslvha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hnrC (C:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnrC (C:)
    apaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqad
    ltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvktvetqvaeligtnaiapf
    lltmsfaqrqssnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvn
    gvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvd
    gglslvha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hnrD (D:)
    mgsshhhhhhssglvprgshmeapaavvtgaakrigraiavklhqtgyrvvihyhnsaea
    avsladelnkersntavvcqadltnsnvlpasceeiinscfrafgrcdvlvnnasafypt
    plvqgdhednsngktvetqvaeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlc
    damvdqpcmafslynmgkhalvgltqsaalelapygirvngvapgvsllpvamgeeekdk
    wrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnrD (D:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha