PDB entry 6hnn

View 6hnn on RCSB PDB site
Description: Crystal structure of wild-type IdmH, a putative polyketide cyclase from Streptomyces antibioticus
Class: biosynthetic protein
Keywords: Polyketide synthesis, putative cyclase, BIOSYNTHETIC PROTEIN
Deposited on 2018-09-16, released 2019-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative polyketide cyclase IdmH
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: idmH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnna_
  • Chain 'B':
    Compound: Putative polyketide cyclase IdmH
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: idmH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnnb_
  • Chain 'C':
    Compound: Putative polyketide cyclase IdmH
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: idmH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnnc_
  • Chain 'D':
    Compound: Putative polyketide cyclase IdmH
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: idmH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnnd_
  • Chain 'E':
    Compound: Putative polyketide cyclase IdmH
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: idmH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnne_
  • Chain 'F':
    Compound: Putative polyketide cyclase IdmH
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: idmH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnnf_
  • Chain 'G':
    Compound: Putative polyketide cyclase IdmH
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: idmH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnng_
  • Chain 'H':
    Compound: Putative polyketide cyclase IdmH
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: idmH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnnh_
  • Chain 'I':
    Compound: Putative polyketide cyclase IdmH
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: idmH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnni_
  • Chain 'J':
    Compound: Putative polyketide cyclase IdmH
    Species: Streptomyces antibioticus [TaxId:1890]
    Gene: idmH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hnnj_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hnnA (A:)
    gshmahqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwl
    gvwqftqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsr
    vrdgrivehwtisdnvtmlaqlgvkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnnA (A:)
    hqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqf
    tqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsrvrdgr
    ivehwtisdnvtmlaqlgvka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hnnB (B:)
    gshmahqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwl
    gvwqftqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsr
    vrdgrivehwtisdnvtmlaqlgvkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnnB (B:)
    hqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqf
    tqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsrvrdgr
    ivehwtisdnvtmlaqlg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hnnC (C:)
    gshmahqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwl
    gvwqftqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsr
    vrdgrivehwtisdnvtmlaqlgvkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnnC (C:)
    hqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqf
    tqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsrvrdgr
    ivehwtisdnvtmlaqlg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hnnD (D:)
    gshmahqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwl
    gvwqftqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsr
    vrdgrivehwtisdnvtmlaqlgvkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnnD (D:)
    hqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqf
    tqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsrvrdgr
    ivehwtisdnvtmlaqlgv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6hnnE (E:)
    gshmahqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwl
    gvwqftqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsr
    vrdgrivehwtisdnvtmlaqlgvkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnnE (E:)
    qpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqft
    qaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsrvrdgri
    vehwtisdnvtmlaqlgv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6hnnF (F:)
    gshmahqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwl
    gvwqftqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsr
    vrdgrivehwtisdnvtmlaqlgvkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnnF (F:)
    qpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqft
    qaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsrvrdgri
    vehwtisdnvtmlaql
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6hnnG (G:)
    gshmahqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwl
    gvwqftqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsr
    vrdgrivehwtisdnvtmlaqlgvkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnnG (G:)
    qpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqft
    qaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsrvrdgri
    vehwtisdnvtmlaqlgv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6hnnH (H:)
    gshmahqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwl
    gvwqftqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsr
    vrdgrivehwtisdnvtmlaqlgvkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnnH (H:)
    hqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqf
    tqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsrvrdgr
    ivehwtisdnvtmlaqlgv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6hnnI (I:)
    gshmahqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwl
    gvwqftqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsr
    vrdgrivehwtisdnvtmlaqlgvkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnnI (I:)
    hqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqf
    tqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsrvrdgr
    ivehwtisdnvtmlaqlgv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6hnnJ (J:)
    gshmahqpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwl
    gvwqftqaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsr
    vrdgrivehwtisdnvtmlaqlgvkasl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hnnJ (J:)
    qpsdtiaglyeafnsgdletlreliapdavihlpgtagdaehppgtprdregwlgvwqft
    qaffpdmtatvqdivqtgdlvatrcvargthsiefmgvpptgrpfemtmlnmsrvrdgri
    vehwtisdnvtmlaqlgv