PDB entry 6hnk

View 6hnk on RCSB PDB site
Description: the ligand-free, open structure of cd0873, a substrate binding protein with adhesive properties from clostridium difficile.
Deposited on 2018-09-15, released 2019-08-28
The last revision was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC-type transport system, sugar-family extracellular solute-binding protein
    Species: Peptoclostridium difficile 630 [TaxId:272563]
    Gene: CD630_08730
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hnkA (A:)
    smasqggdsgnskqesnskdkevkkigitqlvehpaldatrtgfvkalekngfkdgenid
    idfqnaqndmpttqsiaskfasdkkdlifaistpsaqaafnatkdipilitavsdpvaag
    lvktlekpgtnvsgtsdfvsvdkglellkifapkaktigvmyntsevnskvqvdalkeya
    skngfkvvekgittsnevnqgisslvgkidvlyvptdnlvassmpivskiatenkipvia
    aesgpvekgalacqginyeklgyktgemavkilngesvsdmpvatsddtdiivnedilka
    lgmekpsnenisyvktkqe
    

    Sequence, based on observed residues (ATOM records):
    >6hnkA (A:)
    vkkigitqlvehpaldatrtgfvkalekngfkdgenididfqnaqndmpttqsiaskfas
    dkkdlifaistpsaqaafnatkdipilitavsdpvaaglvktlekpgtnvsgtsdfvsvd
    kglellkifapkaktigvmyntsevnskvqvdalkeyaskngfkvvekgittsnevnqgi
    sslvgkidvlyvptdnlvassmpivskiatenkipviaaesgpvekgalacqginyeklg
    yktgemavkilngesvsdmpvatsddtdiivnedilkalgmekpsnenisyvktk