PDB entry 6hnf

View 6hnf on RCSB PDB site
Description: Structure in solution of human fibronectin type III-domain 14
Class: cell adhesion
Keywords: Fibronectin type III-domain 14, CELL ADHESION
Deposited on 2018-09-14, released 2018-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: FN1, FN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02751 (3-90)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d6hnfa1, d6hnfa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hnfA (A:)
    ghmdapsnlrflattpnsllvswqppraritgyiikyekpgspprevvprprpgvteati
    tglepgteytiyvialknnqksepligrkkt