PDB entry 6hnb

View 6hnb on RCSB PDB site
Description: crystal structure of aminotransferase aro8 from candida albicans
Deposited on 2018-09-14, released 2019-02-20
The last revision was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aromatic amino acid aminotransferase I
    Species: Candida albicans WO-1 [TaxId:294748]
    Gene: CAWG_03814
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4YJ02 (Start-490)
      • conflict (110)
  • Chain 'B':
    Compound: Aromatic amino acid aminotransferase I
    Species: Candida albicans WO-1 [TaxId:294748]
    Gene: CAWG_03814
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4YJ02 (Start-490)
      • conflict (110)
  • Heterogens: BTB, SO4, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hnbA (A:)
    mtsdtkpqakdlthllsneskarqtsplkgifkyykqpgitflggglplsdyfpfekvta
    diptpsfsggigapiegenkttievfkkaadnvpdqielarslqygstfglpeflqfike
    htdmvhkvpyenwdvivsvgnteawdstlrtfcskgdtilveeytfssalesangqgvnt
    vpvtmdefgiipekleelmsrwvgnkpkflytictgqnptgsslsaerrkqiydiackyd
    fliiedepyyflqmetytkdkaaregkavhdhdeflkalvpsfisldvegrvvrldsfsk
    vlapglrlgwivgqkdlleryvrlhevsvqnpsgfsealanallrkwghsgyldwliglr
    aeythkrdvaidaldqfvpkevssfnppvagmfftvtldaskhpkykefledplkveaav
    heqaikqgcllapgswfkaegqssppqknlpanpshkthiffrgtyaavpldqlvvglek
    fgkavraefgl
    

    Sequence, based on observed residues (ATOM records):
    >6hnbA (A:)
    tkpqakdlthllsneskarqtsplkgifkyykqpgitflggglplsdyfpfekvtadipt
    psfsggigapiegenkttievfkkaadnvpdqielarslqygstfglpeflqfikehtdm
    vhkvpyenwdvivsvgnteawdstlrtfcskgdtilveeytfssalesangqgvntvpvt
    mdefgiipekleelmsrwvgnkpkflytictgqnptgsslsaerrkqiydiackydflii
    edepyyflqmetytkdkaaregkavhdhdeflkalvpsfisldvegrvvrldsfskvlap
    glrlgwivgqkdlleryvrlhevsvqnpsgfsealanallrkwghsgyldwliglraeyt
    hkrdvaidaldqfvpkevssfnppvagmfftvtldaskhpkykefledplkveaavheqa
    ikqgcllapgswfkaegqssppqknkthiffrgtyaavpldqlvvglekfgkavraefgl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hnbB (B:)
    mtsdtkpqakdlthllsneskarqtsplkgifkyykqpgitflggglplsdyfpfekvta
    diptpsfsggigapiegenkttievfkkaadnvpdqielarslqygstfglpeflqfike
    htdmvhkvpyenwdvivsvgnteawdstlrtfcskgdtilveeytfssalesangqgvnt
    vpvtmdefgiipekleelmsrwvgnkpkflytictgqnptgsslsaerrkqiydiackyd
    fliiedepyyflqmetytkdkaaregkavhdhdeflkalvpsfisldvegrvvrldsfsk
    vlapglrlgwivgqkdlleryvrlhevsvqnpsgfsealanallrkwghsgyldwliglr
    aeythkrdvaidaldqfvpkevssfnppvagmfftvtldaskhpkykefledplkveaav
    heqaikqgcllapgswfkaegqssppqknlpanpshkthiffrgtyaavpldqlvvglek
    fgkavraefgl
    

    Sequence, based on observed residues (ATOM records):
    >6hnbB (B:)
    kpqakdlthllsneskarqtsplkgifkyykqpgitflggglplsdyfpfekvtadiptp
    sfsggigapiegenkttievfkkaadnvpdqielarslqygstfglpeflqfikehtdmv
    hkvpyenwdvivsvgnteawdstlrtfcskgdtilveeytfssalesangqgvntvpvtm
    defgiipekleelmsrwvgnkpkflytictgqnptgsslsaerrkqiydiackydfliie
    depyyflqmetytkdkaaregkavhdhdeflkalvpsfisldvegrvvrldsfskvlapg
    lrlgwivgqkdlleryvrlhevsvqnpsgfsealanallrkwghsgyldwliglraeyth
    krdvaidaldqfvpkevssfnppvagmfftvtldaskhpkykefledplkveaavheqai
    kqgcllapgswfkaegqssppqknkthiffrgtyaavpldqlvvglekfgkavraefgl