PDB entry 6hn9

View 6hn9 on RCSB PDB site
Description: nicomicin-1 -- novel antimicrobial peptides from the arctic polychaeta nicomache minor provide new molecular insight into biological role of the brichos domain
Deposited on 2018-09-14, released 2018-11-07
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nicomicin-1
  Species: Nicomache minor [TaxId:1441599]
  Database cross-references and differences (RAF-indexed):
  • PDB 6HN9 (0-32)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6hn9A (A:)
  gfwssvwdgaknvgtaiiknakvcvyavcvshk