PDB entry 6hn6

View 6hn6 on RCSB PDB site
Description: A revisited version of the apo structure of the ligand-binding domain of the human nuclear receptor RXR-ALPHA
Class: transcription
Keywords: transcription factor, nuclear receptor, transcription
Deposited on 2018-09-14, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hn6a_
  • Heterogens: CPS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hn6A (A:)
    mgsshhhhhhssglvprgshkreavqeerqrgkdrnenevestssanedmpverileael
    avepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfselplddqvil
    lragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdm
    qmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklll
    rlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hn6A (A:)
    sanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewak
    riphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvga
    ifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayc
    khkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt