PDB entry 6hn2

View 6hn2 on RCSB PDB site
Description: ternary complex of estrogen receptor alpha peptide and 14-3-3 sigma c42 mutant bound to disulfide fragment ppi stabilizer 5
Deposited on 2018-09-13, released 2019-02-27
The last revision was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
      • engineered mutation (42)
      • engineered mutation (46)
  • Chain 'B':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HN2 (Start-7)
  • Heterogens: GF8, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6hn2A (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsneercllsvayknvvggq
    raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
    srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
    fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hn2B (B:)
    aegfpatv
    

    Sequence, based on observed residues (ATOM records):
    >6hn2B (B:)
    fpatv