PDB entry 6hn1

View 6hn1 on RCSB PDB site
Description: Complex of Caprine Serum Albumin with diclofenac
Class: transport protein
Keywords: Caprine serum albumin, Goat serum albumin, diclofenac, nonsteroidal anti-inflammatory drugs, TRANSPORT PROTEIN
Deposited on 2018-09-13, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Albumin
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hn1a1, d6hn1a2, d6hn1a3
  • Heterogens: DIF, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hn1A (A:)
    dthkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadesha
    gcdkslhtlfgdelckvatlretygdmadccekqepernecflkhkddspdlpklkpepd
    tlcaefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    ietmrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkv
    hkecchgdllecaddradlakyicdhqdtlssklkeccdkpvlekshciaeidkdavpen
    lppltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledcc
    akedphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstp
    tlveisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsdltldetyvpkpfdgesftfhadictlpdtekqikkqtalvellkhkpkatd
    eqlktvmenfvafvdkccaaddkegcfllegpklvastqaala