PDB entry 6hmy

View 6hmy on RCSB PDB site
Description: Cholera toxin classical B-pentamer in complex with fucosyl-GM1
Class: toxin
Keywords: Toxin, cholera toxin, lectin, complex, fucosyl-GM1, protein-carbohydrate interactions, X-ray crystal structure
Deposited on 2018-09-13, released 2019-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hmya_
  • Chain 'B':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hmyb_
  • Chain 'C':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hmyc_
  • Chain 'D':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hmyd_
  • Chain 'E':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hmye_
  • Chain 'F':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hmyf_
  • Chain 'G':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hmyg_
  • Chain 'H':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hmyh_
  • Chain 'I':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hmyi_
  • Chain 'J':
    Compound: cholera enterotoxin B-subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, C9J66_18955, EN12_07055, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hmyj_
  • Heterogens: CA, BCN, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmyA (A:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmyB (B:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmyC (C:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmyD (D:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmyE (E:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmyF (F:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmyG (G:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmyH (H:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmyI (I:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hmyJ (J:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman