PDB entry 6hmx

View 6hmx on RCSB PDB site
Description: RIP2 Kinase Catalytic Domain complex with N(4,5dimethyl1Hpyrazol3yl)7methoxy6(2methylpropane2sulfonyl)quinolin4amine
Class: transferase
Keywords: Kinase, kinase inhibitor, Complex, Structure based drug discovery, TRANSFERASE
Deposited on 2018-09-13, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: receptor-interacting serine/threonine-protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RIPK2, CARDIAK, RICK, RIP2, UNQ277/PRO314/PRO34092
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmxa_
  • Chain 'B':
    Compound: receptor-interacting serine/threonine-protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RIPK2, CARDIAK, RICK, RIP2, UNQ277/PRO314/PRO34092
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmxb_
  • Heterogens: GEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hmxA (A:)
    gmngeaicsalptipyhkladlrylsrgasgtvssarhadwrvqvavkhlhihtplldse
    rkdvlreaeilhkarfsyilpilgicnepeflgivteympngslnellhrkteypdvawp
    lrfrilheialgvnylhnmtppllhhdlktqnilldnefhvkiadfglskwrmmslsqsr
    ssksapeggtiiymppenyepgqksrasikhdiysyavitwevlsrkqpfedvtnplqim
    ysvsqghrpvineeslpydiphrarmisliesgwaqnpderpsflkclielepvlrtfee
    itfleaviqlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hmxA (A:)
    aicsalptipyhkladlrylsrgasgtvssarhadwrvqvavkhllldserkdvlreaei
    lhkarfsyilpilgicnepeflgivteympngslnellhrkteypdvawplrfrilheia
    lgvnylhnmtppllhhdlktqnilldnefhvkiadfglskwrggtiiymppenyepsikh
    diysyavitwevlsrkqpfedvtnplqimysvsqghrpvineeslpydiphrarmislie
    sgwaqnpderpsflkclielepvlrtfeeitfleaviqlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hmxB (B:)
    gmngeaicsalptipyhkladlrylsrgasgtvssarhadwrvqvavkhlhihtplldse
    rkdvlreaeilhkarfsyilpilgicnepeflgivteympngslnellhrkteypdvawp
    lrfrilheialgvnylhnmtppllhhdlktqnilldnefhvkiadfglskwrmmslsqsr
    ssksapeggtiiymppenyepgqksrasikhdiysyavitwevlsrkqpfedvtnplqim
    ysvsqghrpvineeslpydiphrarmisliesgwaqnpderpsflkclielepvlrtfee
    itfleaviqlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hmxB (B:)
    aicsalptipyhkladlrylsrgasgtvssarhadwrvqvavkhlrkdvlreaeilhkar
    fsyilpilgicnepeflgivteympngslnellhrkteypdvawplrfrilheialgvny
    lhnmtppllhhdlktqnilldnefhvkiadfglskwrmggtiiymppenyepgqksrasi
    khdiysyavitwevlsrkqpfedvtnplqimysvsqghrpvineeslpydiphrarmisl
    iesgwaqnpderpsflkclielepvlrtfeeitfleaviqlk