PDB entry 6hmv

View 6hmv on RCSB PDB site
Description: crystal structure of human acbd3 gold domain in complex with 3a protein of enterovirus-d68 (fusion protein, lvvy mutant)
Deposited on 2018-09-13, released 2019-07-24
The last revision was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Golgi resident protein GCP60
    Species: Homo sapiens [TaxId:9606]
    Gene: ACBD3, GCP60, GOCAP1, GOLPH1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Genome polyprotein
    Species: Enterovirus D68 [TaxId:42789]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2K9Y515
      • engineered mutation (14)
      • engineered mutation (18)
      • engineered mutation (23)
      • engineered mutation (26)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hmvA (A:)
gameslpviaapsmwtrpqikdfkekiqqdadsvitvgrgevvtvrvptheegsylfwef
atdnydigfgvyfewtdspntavsvhvsessdddeeeeenigceekakknankplldeiv
pvyrrdcheevyagshqypgrgvyllkfdnsyslwrsksvyyrvyytr

    Sequence, based on observed residues (ATOM records):
    >6hmvA (A:)
pviaapsmwtrpqikdfkekiqqdadsvitvgrgevvtvrvptheegsylfwefatdnyd
igfgvyfewtkplldeivpvyrrdcheevyagshqypgrgvyllkfdnsyslwrsksvyy
rvyytr

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hmvB (B:)
gsgsgtpapdaindalrsadsqeardacqkkgwivihpsnelvvekhisr

    Sequence, based on observed residues (ATOM records):
    >6hmvB (B:)
papdaindalrsadsqeardacqkkgwivihpsnelvvekhis