PDB entry 6hmq

View 6hmq on RCSB PDB site
Description: structure of protein kinase ck2 catalytic subunit (isoform ck2alpha'; csnk2a2 gene product) in complex with the benzotriazole-type inhibitor mb002
Class: transferase
Keywords: protein kinase CK2, casein kinase 2, catalytic subunit CK2alpha', CSNK2A2, TRANSFERASE
Deposited on 2018-09-12, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: N/A
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha'
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A2, CK2A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmqa_
  • Heterogens: TRS, EDO, CL, NA, 4B0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hmqA (A:)
    mgsshhhhhhsqdpmpgpaagsrarvyaevnslrsreywdyeahvpswgnqddyqlvrkl
    grgkysevfeainitnnervvvkilkpvkkkkikrevkilenlrggtniiklidtvkdpv
    sktpalvfeyinntdfkqlyqiltdfdirfymyellkaldychskgimhrdvkphnvmid
    hqqkklrlidwglaefyhpaqeynvrvasryfkgpellvdyqmydysldmwslgcmlasm
    ifrrepffhgqdnydqlvriakvlgteelygylkkyhidldphfndilgqhsrkrwenfi
    hsenrhlvspealdlldkllrydhqqrltakeamehpyfypvvkeqsqpsadnavlssgl
    taar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hmqA (A:)
    gsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgrgkysevfeainitnnerv
    vvkilkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfeyinntdfkqly
    qiltdfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrlidwglaefyhpa
    qeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffhgqdnydqlvri
    akvlgteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvspealdlldkll
    rydhqqrltakeamehpyfypvvkeqs