PDB entry 6hmp

View 6hmp on RCSB PDB site
Description: Crystal structure of human Casein Kinase I delta in complex with a photoswitchable 2-Azoimidazole-based Inhibitor (compound 3)
Class: transferase
Keywords: Kinase, Photoswitchable Inhibitor, Complex, TRANSFERASE
Deposited on 2018-09-12, released 2019-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmpa_
  • Chain 'B':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmpb_
  • Heterogens: GEW, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hmpA (A:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hmpA (A:)
    ryrlgrkigsgsfgdiylgtdiaaeevaiklecvktkhpqlhieskiykmmqggvgipti
    rwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrd
    vkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgi
    eqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsef
    atylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hmpB (B:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hmpB (B:)
    melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvhpqlhieskiykmmqggv
    giptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihskn
    fihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasin
    thlgieqsrrddleslgyvlmyfnlgslpwqrisekkmstpievlckgypsefatylnfc
    rslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml