PDB entry 6hme

View 6hme on RCSB PDB site
Description: LOW-SALT STRUCTURE OF PROTEIN KINASE CK2 CATALYTIC SUBUNIT (ISOFORM CK2ALPHA; CSNK2A1 gene product) IN COMPLEX WITH THE INDENOINDOLE-TYPE INHIBITOR THN27
Class: transferase
Keywords: protein kinase CK2, casein kinase 2, catalytic subunit CK2alpha, CSNK2A1, indenoindole-type inhibitor, TRANSFERASE
Deposited on 2018-09-12, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A1, CK2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmea_
  • Chain 'B':
    Compound: Casein kinase II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A1, CK2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmeb_
  • Heterogens: EDO, CL, SO4, FXB, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hmeA (A:)
    mgsshhhhhhsqdpmsgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklg
    rgkysevfeainitnnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvs
    rtpalvfehvnntdfkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidh
    ehrklrlidwglaefyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmi
    frkepffhghdnydqlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvh
    senqhlvspealdfldkllrydhqsrltareamehpyfytvvkdqarmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hmeA (A:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvkdqar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hmeB (B:)
    mgsshhhhhhsqdpmsgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklg
    rgkysevfeainitnnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvs
    rtpalvfehvnntdfkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidh
    ehrklrlidwglaefyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmi
    frkepffhghdnydqlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvh
    senqhlvspealdfldkllrydhqsrltareamehpyfytvvkdqarmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hmeB (B:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvkdqar