PDB entry 6hmd

View 6hmd on RCSB PDB site
Description: STRUCTURE OF PROTEIN KINASE CK2 CATALYTIC SUBUNIT (ISOFORM CK2ALPHA'; CSNK2A2 gene product) IN COMPLEX WITH THE INDENOINDOLE-TYPE INHIBITOR AR18
Class: transferase
Keywords: protein kinase CK2, casein kinase 2, catalytic subunit ck2alpha', csnk2a2, indeno[1, 2-b]indole-type inhibitor, TRANSFERASE
Deposited on 2018-09-12, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha'
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A2, CK2A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hmda_
  • Heterogens: EDO, GDW, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hmdA (A:)
    hmgsshhhhhhsqdpmpgpaagsrarvyaevnslrsreywdyeahvpswgnqddyqlvrk
    lgrgkysevfeainitnnervvvkilkpvkkkkikrevkilenlrggtniiklidtvkdp
    vsktpalvfeyinntdfkqlyqiltdfdirfymyellkaldychskgimhrdvkphnvmi
    dhqqkklrlidwglaefyhpaqeynvrvasryfkgpellvdyqmydysldmwslgcmlas
    mifrrepffhgqdnydqlvriakvlgteelygylkkyhidldphfndilgqhsrkrwenf
    ihsenrhlvspealdlldkllrydhqqrltakeamehpyfypvvkeqsqpsadnavlssg
    ltaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hmdA (A:)
    gsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgrgkysevfeainitnnerv
    vvkilkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfeyinntdfkqly
    qiltdfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrlidwglaefyhpa
    qeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffhgqdnydqlvri
    akvlgteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvspealdlldkll
    rydhqqrltakeamehpyfypvvkeqsq