PDB entry 6hlf

View 6hlf on RCSB PDB site
Description: X-ray structure of Lactobacillus brevis alcohol dehydrogenase mutant - K32A
Class: oxidoreductase
Keywords: short chain reductases/dehydrogenases, magnesium dependence, R-specific alcohol dehydrogenase, Oxidoreductase
Deposited on 2018-09-11, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: R-specific alcohol dehydrogenase
    Species: LACTOBACILLUS BREVIS [TaxId:1580]
    Gene: radh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84EX5 (11-261)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d6hlfa_
  • Heterogens: MG, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hlfA (A:)
    mghhhhhhgsgsnrldgkvaiitggtlgiglaiatkfveegaavmitgrhsdvgekaaks
    vgtpdqiqffqhdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkl
    lavnldgvffgtrlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksa
    aldcalkdydvrvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvyl
    asneskfatgsefvvdggytaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hlfA (A:)
    snrldgkvaiitggtlgiglaiatkfveegaavmitgrhsdvgekaaksvgtpdqiqffq
    hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
    trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
    rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
    efvvdggytaq