PDB entry 6hkv

View 6hkv on RCSB PDB site
Description: Trichodysplasia spinulosa-associated polyomavirus (TSPyV) VP1 in complex with sialylated precision glycooligomers
Class: viral protein
Keywords: sialic acid derivative, viral protein
Deposited on 2018-09-08, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot E2ESL7 (0-271)
      • conflict (75)
    Domains in SCOPe 2.07: d6hkva_
  • Chain 'B':
    Compound: Capsid protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hkvb_
  • Chain 'C':
    Compound: Capsid protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot E2ESL7 (0-271)
      • conflict (75)
    Domains in SCOPe 2.07: d6hkvc_
  • Chain 'D':
    Compound: Capsid protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hkvd_
  • Chain 'E':
    Compound: Capsid protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hkve_
  • Chain 'F':
    Compound: Capsid protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot E2ESL7 (0-271)
      • conflict (75)
    Domains in SCOPe 2.07: d6hkvf_
  • Chain 'G':
    Compound: Capsid protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot E2ESL7 (Start-271)
      • conflict (75)
    Domains in SCOPe 2.07: d6hkvg_
  • Chain 'H':
    Compound: Capsid protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hkvh_
  • Chain 'I':
    Compound: Capsid protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot E2ESL7 (0-271)
      • conflict (75)
    Domains in SCOPe 2.07: d6hkvi_
  • Chain 'J':
    Compound: Capsid protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot E2ESL7 (0-End)
      • conflict (75)
    Domains in SCOPe 2.07: d6hkvj_
  • Heterogens: GXB, MG, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hkvA (A:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
    nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
    ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
    ivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hkvA (A:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmledltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmn
    fhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpve
    cwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdi
    vgflvgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hkvB (B:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
    nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
    ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
    ivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hkvB (B:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfa
    vggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpd
    psknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflv
    gkdgdmqyrglpryfnillrkrtvr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hkvC (C:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
    nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
    ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
    ivgflvgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hkvD (D:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
    nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
    ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
    ivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hkvD (D:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmltltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfav
    ggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpdp
    sknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflvg
    kdgdmqyrglpryfnillrkrtvr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6hkvE (E:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
    nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
    ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
    ivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hkvE (E:)
    ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys
    tarinlpmlnntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfa
    vggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpd
    psknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflv
    gkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hkvF (F:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
    nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
    ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
    ivgflvgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6hkvG (G:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
    nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
    ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
    ivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hkvG (G:)
    ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys
    tarinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmn
    fhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpve
    cwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdi
    vgflvgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6hkvH (H:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
    nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
    ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
    ivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hkvH (H:)
    ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys
    tarinlpmlntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfav
    ggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpdp
    sknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflvg
    kdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6hkvI (I:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
    nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
    ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
    ivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hkvI (I:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhm
    favggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwc
    pdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgf
    lvgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6hkvJ (J:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnedltsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
    nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
    ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
    ivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hkvJ (J:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlsntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmf
    avggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcp
    dpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgfl
    vgkdgdmqyrglpryfnillrkrtvr