PDB entry 6hks

View 6hks on RCSB PDB site
Description: Crystal structure of the PTPN3 PDZ domain bound to the HPV16 E6 oncoprotein C-terminal peptide
Class: hydrolase
Keywords: PDZ domain Protein tyrosine phosphatase Human papillomavirus E6 oncoprotein PDZ binding motif, HYDROLASE
Deposited on 2018-09-07, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN3, PTPH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hksa_
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase non-receptor type 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN3, PTPH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hksb_
  • Chain 'C':
    Compound: Tyrosine-protein phosphatase non-receptor type 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN3, PTPH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hksc_
  • Chain 'D':
    Compound: Tyrosine-protein phosphatase non-receptor type 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN3, PTPH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hksd_
  • Chain 'E':
    Compound: Tyrosine-protein phosphatase non-receptor type 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN3, PTPH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hkse_
  • Chain 'F':
    Compound: Tyrosine-protein phosphatase non-receptor type 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN3, PTPH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hksf_
  • Chain 'G':
    Compound: Protein E6
    Species: Human papillomavirus type 16 [TaxId:333760]
    Gene: E6
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Protein E6
    Species: Human papillomavirus type 16 [TaxId:333760]
    Gene: E6
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Protein E6
    Species: Human papillomavirus type 16 [TaxId:333760]
    Gene: E6
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Protein E6
    Species: Human papillomavirus type 16 [TaxId:333760]
    Gene: E6
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Protein E6
    Species: Human papillomavirus type 16 [TaxId:333760]
    Gene: E6
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Protein E6
    Species: Human papillomavirus type 16 [TaxId:333760]
    Gene: E6
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hksA (A:)
    gamgsstedasqyycdkndngdsylvliritpdedgkfgfnlkggvdqkmplvvsrinpe
    spadtcipklnegdqivlingrdisehthdqvvmfikasreshsrelalvirrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hksA (A:)
    dsylvliritpdedgkfgfnlkggvdqkmplvvsrinpespadtcipklnegdqivling
    rdisehthdqvvmfikasreshsrelalvirrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hksB (B:)
    gamgsstedasqyycdkndngdsylvliritpdedgkfgfnlkggvdqkmplvvsrinpe
    spadtcipklnegdqivlingrdisehthdqvvmfikasreshsrelalvirrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hksB (B:)
    gdsylvliritpdedgkfgfnlkggvdqkmplvvsrinpespadtcipklnegdqivlin
    grdisehthdqvvmfikasreshsrelalvirrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hksC (C:)
    gamgsstedasqyycdkndngdsylvliritpdedgkfgfnlkggvdqkmplvvsrinpe
    spadtcipklnegdqivlingrdisehthdqvvmfikasreshsrelalvirrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hksC (C:)
    sylvliritpdedgkfgfnlkggvdqkmplvvsrinpespadtcipklnegdqivlingr
    disehthdqvvmfikasreshsrelalvirr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hksD (D:)
    gamgsstedasqyycdkndngdsylvliritpdedgkfgfnlkggvdqkmplvvsrinpe
    spadtcipklnegdqivlingrdisehthdqvvmfikasreshsrelalvirrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hksD (D:)
    dsylvliritpdedgkfgfnlkggvdqkmplvvsrinpespadtcipklnegdqivling
    rdisehthdqvvmfikasreshsrelalvirr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6hksE (E:)
    gamgsstedasqyycdkndngdsylvliritpdedgkfgfnlkggvdqkmplvvsrinpe
    spadtcipklnegdqivlingrdisehthdqvvmfikasreshsrelalvirrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hksE (E:)
    dsylvliritpdedgkfgfnlkggvdqkmplvvsrinpespadtcipklnegdqivling
    rdisehthdqvvmfikasreshsrelalvirrr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6hksF (F:)
    gamgsstedasqyycdkndngdsylvliritpdedgkfgfnlkggvdqkmplvvsrinpe
    spadtcipklnegdqivlingrdisehthdqvvmfikasreshsrelalvirrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hksF (F:)
    dsylvliritpdedgkfgfnlkggvdqkmplvvsrinpespadtcipklnegdqivling
    rdisehthdqvvmfikasreshsrelalvirrr
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.