PDB entry 6hkr

View 6hkr on RCSB PDB site
Description: Human Cellular Retinoic Acid Binding Protein II (CRABPII) with bound synthetic retinoid DC271.
Class: signaling protein
Keywords: Retinoid, Fluorescent, DC271, CRABPII, SIGNALING PROTEIN
Deposited on 2018-09-07, released 2018-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hkra_
  • Heterogens: G9Q, EDO, GOL, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hkrA (A:)
mpnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvr
tteinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgel
iltmtaddvvctrvyvre