PDB entry 6hkq

View 6hkq on RCSB PDB site
Description: Human GPX4 in complex with covalent Inhibitor ML162 (S enantiomer)
Class: oxidoreductase
Keywords: ANTI-OXIDATVE DEFENSE SYSTEM, Covalent inhibitor, OXIDOREDUCTASE
Deposited on 2018-09-07, released 2020-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipid hydroperoxide glutathione peroxidase
    Species: Homo sapiens [TaxId:9606]
    Gene: GPX4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36969 (Start-169)
      • engineered mutation (65)
      • expression tag (170)
    Domains in SCOPe 2.07: d6hkqa1, d6hkqa2
  • Heterogens: G9N, SO4, EDO, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hkqA (A:)
    mcasrddwrcarsmhefsakdidghmvnldkyrgfvcivtnvasqagktevnytqlvdlh
    aryaesglrilafpcnqfgkqepgsneeikefaagynvkfdmfskicvngddahplwkwm
    kiqpkgkgilgnaikwnftkflidkngcvvkrygpmeeplviekdlphyfhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hkqA (A:)
    ddwrcarsmhefsakdidghmvnldkyrgfvcivtnvasqagktevnytqlvdlharyae
    sglrilafpcnqfgkqepgsneeikefaagynvkfdmfskicvngddahplwkwmkiqpk
    gkgilgnaikwnftkflidkngcvvkrygpmeeplviekdlphyfh