PDB entry 6hkp

View 6hkp on RCSB PDB site
Description: factor inhibiting hif (fih) in complex with zinc, nog and aspp2 (970- 992)
Deposited on 2018-09-07, released 2019-09-18
The last revision was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: HIF1AN, FIH1
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: apoptosis-stimulating of p53 protein 2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, OGA, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hkpA (A:)
    smaataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeeliene
    epvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsn
    reemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgw
    gqltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrq
    sqvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykg
    aptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records):
    >6hkpA (A:)
    gsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvy
    palkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefvek
    lqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligm
    egnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyer
    fpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplk
    ahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >6hkpS (S:)
    ghteivkflvqfgvnvnaadsdg
    

    Sequence, based on observed residues (ATOM records):
    >6hkpS (S:)
    vkflvqfgvnvnaa