PDB entry 6hkn

View 6hkn on RCSB PDB site
Description: Crystal structure of Compound 35 with ERK5
Class: transferase
Keywords: erk5 kinase, transferase
Deposited on 2018-09-07, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK7, BMK1, ERK5, PRKM7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hkna_
  • Heterogens: G9E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hknA (A:)
    eyeiietigngaygvvssarrrltgqqvaikkipnafdvvtnakrtlrelkilkhfkhdn
    iiaikdilrptvpygefksvyvvldlmesdlhqiihssqpltlehvryflyqllrglkym
    hsaqvihrdlkpsnllvnencelkigdfgmarglctspaehqyfmteyvatrwyrapelm
    lslheytqaidlwsvgcifgemlarrqlfpgknyvhqlqlimmvlgtpspaviqavgaer
    vrayiqslpprqpvpwetvypgadrqalsllgrmlrfepsarisaaaalrhpflakyhdp
    ddepdcappfdfafdrealtrerikeaivaeiedfharre
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hknA (A:)
    eyeiietiaygvvssarrqqvaikkipnafdvvtnakrtlrelkilkhfkhdniiaikdi
    lrptvpygefksvyvvldlmesdlhqiihssqpltlehvryflyqllrglkymhsaqvih
    rdlkpsnllvnencelkigdfgmarglctspaehqyfmteyvatrwyrapelmlslheyt
    qaidlwsvgcifgemlarrqlfpgknyvhqlqlimmvlgtpspaviqavgaervrayiqs
    lpprqpvpwetvypgadrqalsllgrmlrfepsarisaaaalrhpflakyhdpddepdca
    ppfdfafdrealtrerikeaivaeiedfharre