PDB entry 6hkc

View 6hkc on RCSB PDB site
Description: solution structure of the sushi 1 domain of gababr1a
Deposited on 2018-09-06, released 2019-01-23
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyric acid type B receptor subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GABBR1, GPRC3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBS5 (2-74)
      • expression tag (0-1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6hkcA (A:)
gptsegcqiihppweggiryrgltrdqvkainflpvdyeieyvcrgerevvgpkvrkcla
ngswtdmdtpsrcvr