PDB entry 6hka

View 6hka on RCSB PDB site
Description: the solution structure of the micelle-associated fatc domain of the human protein kinase ataxia telangiectasia mutated (atm)
Deposited on 2018-09-06, released 2019-03-27
The last revision was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G,Serine-protein kinase ATM
    Species: Homo sapiens [TaxId:9606]
    Gene: ATM
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hkaA (A:)
mqyklalngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvtelvpr
gsddddktvlsvggqvnlliqqaidpknlsrlfpgwkawv

    Sequence, based on observed residues (ATOM records):
    >6hkaA (A:)
tvlsvggqvnlliqqaidpknlsrlfpgwkawv