PDB entry 6hjy

View 6hjy on RCSB PDB site
Description: X-ray structure of a pentameric ligand gated ion channel from Erwinia chrysanthemi (ELIC) Delta8 truncation mutant in complex with nanobody 72
Class: membrane protein
Keywords: ion channel, pentameric ligand-gated ion channel, cya-loop receptor, MEMBRANE PROTEIN
Deposited on 2018-09-04, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-276)
      • insertion (155)
      • conflict (229)
  • Chain 'B':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (2-279)
      • expression tag (1)
      • insertion (158)
      • conflict (232)
  • Chain 'C':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (2-279)
      • expression tag (1)
      • insertion (158)
      • conflict (232)
  • Chain 'D':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-275)
      • insertion (154)
      • conflict (228)
  • Chain 'E':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-277)
      • insertion (156)
      • conflict (230)
  • Chain 'F':
    Compound: nanobody 72
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HJY (0-123)
    Domains in SCOPe 2.07: d6hjyf1, d6hjyf2
  • Chain 'G':
    Compound: nanobody 72
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HJY (0-122)
    Domains in SCOPe 2.07: d6hjyg_
  • Chain 'H':
    Compound: nanobody 72
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HJY (0-122)
    Domains in SCOPe 2.07: d6hjyh_
  • Chain 'I':
    Compound: nanobody 72
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HJY (0-122)
    Domains in SCOPe 2.07: d6hjyi_
  • Chain 'J':
    Compound: nanobody 72
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HJY (0-123)
    Domains in SCOPe 2.07: d6hjyj1, d6hjyj2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjyF (F:)
    qvqlqesggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvy
    adfvkgrftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqv
    tvss
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjyG (G:)
    vqlqesggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvya
    dfvkgrftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqvt
    vss
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjyH (H:)
    vqlqesggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvya
    dfvkgrftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqvt
    vss
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjyI (I:)
    vqlqesggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvya
    dfvkgrftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqvt
    vss
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjyJ (J:)
    qvqlqesggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvy
    adfvkgrftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqv
    tvss