PDB entry 6hjx

View 6hjx on RCSB PDB site
Description: X-ray structure of a pentameric ligand gated ion channel from Erwinia chrysanthemi (ELIC) 7'C pore mutant (L238C) in complex with nanobody 72
Class: membrane protein
Keywords: ion channel, pentameric ligand-gated ion channel, cya-loop receptor, MEMBRANE PROTEIN
Deposited on 2018-09-04, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-305)
      • insertion (155)
      • engineered mutation (229)
      • engineered mutation (291)
      • engineered mutation (304)
  • Chain 'B':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (2-308)
      • expression tag (0-1)
      • insertion (158)
      • engineered mutation (232)
      • conflict (283)
      • engineered mutation (294)
      • engineered mutation (307)
  • Chain 'C':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (2-311)
      • expression tag (0-1)
      • insertion (158)
      • engineered mutation (232)
      • engineered mutation (294)
      • engineered mutation (307)
  • Chain 'D':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-309)
      • insertion (155)
      • engineered mutation (229)
      • engineered mutation (291)
      • engineered mutation (304)
  • Chain 'E':
    Compound: cys-loop ligand-gated ion channel
    Species: Dickeya chrysanthemi [TaxId:556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C7B7 (0-306)
      • insertion (156)
      • engineered mutation (230)
      • engineered mutation (292)
      • engineered mutation (305)
  • Chain 'F':
    Compound: nanobody 72
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HJX (0-123)
    Domains in SCOPe 2.07: d6hjxf1, d6hjxf2
  • Chain 'G':
    Compound: nanobody 72
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HJX (Start-123)
    Domains in SCOPe 2.07: d6hjxg1, d6hjxg2
  • Chain 'H':
    Compound: nanobody 72
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HJX
    Domains in SCOPe 2.07: d6hjxh1, d6hjxh2
  • Chain 'I':
    Compound: nanobody 72
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HJX
    Domains in SCOPe 2.07: d6hjxi1, d6hjxi2
  • Chain 'J':
    Compound: nanobody 72
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HJX (0-123)
    Domains in SCOPe 2.07: d6hjxj1, d6hjxj2
  • Heterogens: PTY, P6G, LMT, MES, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjxF (F:)
    qvqlqesggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvy
    adfvkgrftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqv
    tvss
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6hjxG (G:)
    qvqlqesggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvy
    adfvkgrftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqv
    tvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hjxG (G:)
    qlqesggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvyad
    fvkgrftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqvtv
    ss
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6hjxH (H:)
    qvqlqesggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvy
    adfvkgrftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqv
    tvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hjxH (H:)
    vqlqesggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvya
    dfvkgrftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqvt
    vs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6hjxI (I:)
    qvqlqesggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvy
    adfvkgrftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqv
    tvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hjxI (I:)
    qlqesggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvyad
    fvkgrftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqvtv
    s
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjxJ (J:)
    qvqlqesggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvy
    adfvkgrftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqv
    tvss