PDB entry 6hjf

View 6hjf on RCSB PDB site
Description: Trypanosoma cruzi proline racemase in complex with inhibitor BrOxoPA
Class: isomerase
Keywords: proline racemase, drug design, michael reaction, suicide substrate, isomerase
Deposited on 2018-09-03, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proline racemase A
    Species: Trypanosoma cruzi (strain CL Brener) [TaxId:353153]
    Gene: PA45-A, Tc00.1047053506795.80
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4DA80 (Start-392)
      • conflict (117)
      • expression tag (393)
    Domains in SCOPe 2.07: d6hjfa1, d6hjfa2
  • Chain 'B':
    Compound: Proline racemase A
    Species: Trypanosoma cruzi (strain CL Brener) [TaxId:353153]
    Gene: PA45-A, Tc00.1047053506795.80
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4DA80 (Start-392)
      • conflict (117)
      • expression tag (393-397)
    Domains in SCOPe 2.07: d6hjfb1, d6hjfb2
  • Heterogens: SHF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hjfA (A:)
    mgqekllfdqkykiikgekkekkknqranrrehqqkreimrfkksftcidmhtegeaari
    vtsglphipgsnmaekkaylqenmdylrrgimleprghddmfgaflfdpieegadlgivf
    mdtggylnmcghnsiaavtaavetgivsvpakatnvpvvldtpaglvrgtahlqsgtese
    vsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnffaivpaeqlgidisvqnlsrl
    qeagellrteinrsvkvqhpqlphintvdcveiygpptnpeanyknvvifgnrqadrspc
    gtgtsakmatlyakgqlrigetfvyesilgslfqgrvlgeeripgvkvpvtkdaeegmlv
    vtaeitgkafimgfntmlfdptdpfkngftlkqyiwsssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hjfA (A:)
    mrfkksftcidmhtegeaarivtsglphipgsnmaekkaylqenmdylrrgimleprghd
    dmfgaflfdpieegadlgivfmdtggylnmcghnsiaavtaavetgivsvpakatnvpvv
    ldtpaglvrgtahlqsgtesevsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnf
    faivpaeqlgidisvqnlsrlqeagellrteinrsvkvqhpqlphintvdcveiygpptn
    peanyknvvifgnrqadrspcgtgtsakmatlyakgqlrigetfvyesilgslfqgrvlg
    eeripgvkvpvtkdaeegmlvvtaeitgkafimgfntmlfdptdpfkngftlkqy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hjfB (B:)
    mgqekllfdqkykiikgekkekkknqranrrehqqkreimrfkksftcidmhtegeaari
    vtsglphipgsnmaekkaylqenmdylrrgimleprghddmfgaflfdpieegadlgivf
    mdtggylnmcghnsiaavtaavetgivsvpakatnvpvvldtpaglvrgtahlqsgtese
    vsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnffaivpaeqlgidisvqnlsrl
    qeagellrteinrsvkvqhpqlphintvdcveiygpptnpeanyknvvifgnrqadrspc
    gtgtsakmatlyakgqlrigetfvyesilgslfqgrvlgeeripgvkvpvtkdaeegmlv
    vtaeitgkafimgfntmlfdptdpfkngftlkqyiwsssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hjfB (B:)
    sftcidmhtegeaarivtsglphipgsnmaekkaylqenmdylrrgimleprghddmfga
    flfdpieegadlgivfmdtggylnmcghnsiaavtaavetgivsvpakatnvpvvldtpa
    glvrgtahlqsgtesevsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnffaivp
    aeqlgidisvqnlsrlqeagellrteinrsvkvqhpqlphintvdcveiygpptnpeany
    knvvifgnrqadrspcgtgtsakmatlyakgqlrigetfvyesilgslfqgrvlgeerip
    gvkvpvtkdaeegmlvvtaeitgkafimgfntmlfdptdpfkngftlkqyiwss