PDB entry 6hjd

View 6hjd on RCSB PDB site
Description: Cholera toxin classical B-pentamer in complex with Lewis-x
Class: toxin
Keywords: Toxin, cholera toxin, lectin, complex, Lewis-x, protein-carbohydrate interactions, X-ray crystal structure
Deposited on 2018-09-03, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hjda_
  • Chain 'B':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hjdb_
  • Chain 'C':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hjdc_
  • Chain 'D':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hjdd_
  • Chain 'E':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hjde_
  • Chain 'F':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hjdf_
  • Chain 'G':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hjdg_
  • Chain 'H':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hjdh_
  • Chain 'I':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hjdi_
  • Chain 'J':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hjdj_
  • Heterogens: FUC, CA, BCN, NDG, GAL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjdA (A:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjdB (B:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjdC (C:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjdD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjdE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjdF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjdG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjdH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjdI (I:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hjdJ (J:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman