PDB entry 6hj7

View 6hj7 on RCSB PDB site
Description: The NMR structure of NRADD death domain
Class: membrane protein
Keywords: NRAAD, p45, p75 neurotrophin receptor, bicelles, MEMBRANE PROTEIN
Deposited on 2018-09-01, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death domain-containing membrane protein NRADD
    Species: Mus musculus [TaxId:10090]
    Gene: Nradd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hj7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hj7A (A:)
    pdlgcqlylhipqqqqeevqrllmmgepakgwqelaghlgyqaeavetmacdqmpaytll
    rnwaaqegnratlrvledalaaigredvvqvlsspaesssvv