PDB entry 6hj6

View 6hj6 on RCSB PDB site
Description: crystal structure of loei river virus gp1 glycoprotein at ph 5.0
Deposited on 2018-08-31, released 2018-10-10
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-glycoprotein polyprotein GP complex
    Species: Loei River mammarenavirus [TaxId:1437126]
    Gene: GPC
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A023J4Z7 (Start-161)
      • expression tag (162-163)
  • Heterogens: GOL, NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hj6A (A:)
etgmplscsknnshhyifvgnnsgleltltntsllnhkfcnlsdahkraqydmalmsivs
tfhlsipnfnqyeamscdfngdnitvqynlshasavdaanhcgtvangiletfhkffwsn
nikdayqlpnqgklahcystsyqfliiqnttwedhctfsrptgtkhhhhhh

    Sequence, based on observed residues (ATOM records):
    >6hj6A (A:)
lscsknnshhyifvgnnsgleltltntsllnhkfcnlsdahkraqydmalmsivstfhls
ipnfnqyeamscdfngdnitvqynlshasavdaanhcgtvangiletfhkffwsnnikda
yqlpnqgklahcystsyqfliiqnttwedhctfsrptgt