PDB entry 6hj4

View 6hj4 on RCSB PDB site
Description: crystal structure of whitewater arroyo virus gp1 glycoprotein at ph 7.5
Deposited on 2018-08-31, released 2018-10-10
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-glycoprotein polyprotein GP complex
    Species: Whitewater Arroyo mammarenavirus [TaxId:46919]
    Gene: GPC, GP-C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, CD

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hj4A (A:)
    etgasyitpyvpmpcmindthfllrgpfeaswaikleitdvttlvvdtdnvanptniskc
    fannqderllgftmewflsglehdhhftpqiicgnvskgevnaqvnitmedhcsqvflkm
    rrifgvfknpctshgkqnvlisvsnwtnqcsgnhlsgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hj4A (A:)
    syitpyvpmpcmindthfllrgpfeaswaikleitdvttlvvdtdnvanptniskcfann
    qderllgftmewflsglehdhhftpqiicgnvskgevnaqvnitmedhcsqvflkmrrif
    gvfknpctshgkqnvlisvsnwtnqc