PDB entry 6hj2

View 6hj2 on RCSB PDB site
Description: Crystal structure of hPXR in complex with dabrafenib
Class: nuclear protein
Keywords: pregnane X receptor anti-cancer drug endocrine disruptor nuclear receptor, NUCLEAR PROTEIN
Deposited on 2018-08-31, released 2020-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-25, with a file datestamp of 2020-03-20.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor subfamily 1 group I member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1I2, PXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hj2a_
  • Heterogens: P06, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hj2A (A:)
    mkkghhhhhhgsertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvl
    ssgcelpeslqapreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifsl
    lphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgtw
    ecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqh
    rvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdihp
    fatplmqelfgitgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hj2A (A:)
    vqglteeqrmmirelmdaqmktfdttfshfknfrlpgvaakwsqvrkdlcslkvslqlrg
    edgsvwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpiedqisllk
    gaafelcqlrfntvfnaetgtwecgrlsycledtfqqlllepmlkfhymlkklqlheeey
    vlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltel
    rsinaqhtqrllriqdihpfatplmqelfgitgs