PDB entry 6hit

View 6hit on RCSB PDB site
Description: The crystal structure of haemoglobin from Atlantic cod
Class: oxygen transport
Keywords: Haemoglobin Atlantic cod Gadus morhua, OXYGEN TRANSPORT
Deposited on 2018-08-30, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin alpha 2 chain
    Species: Gadus morhua [TaxId:8049]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hita_
  • Chain 'B':
    Compound: Hemoglobin beta 4 chain
    Species: Gadus morhua [TaxId:8049]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3F9D7 (0-144)
      • conflict (43)
      • conflict (55)
      • conflict (119)
    Domains in SCOPe 2.07: d6hitb_
  • Chain 'C':
    Compound: Hemoglobin alpha 2 chain
    Species: Gadus morhua [TaxId:8049]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hitc_
  • Chain 'D':
    Compound: Hemoglobin beta 4 chain
    Species: Gadus morhua [TaxId:8049]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3F9D7 (0-144)
      • conflict (43)
      • conflict (55)
      • conflict (119)
    Domains in SCOPe 2.07: d6hitd_
  • Chain 'E':
    Compound: Hemoglobin alpha 2 chain
    Species: Gadus morhua [TaxId:8049]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hite_
  • Chain 'F':
    Compound: Hemoglobin beta 4 chain
    Species: Gadus morhua [TaxId:8049]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3F9D7 (0-144)
      • conflict (43)
      • conflict (55)
      • conflict (119)
    Domains in SCOPe 2.07: d6hitf_
  • Chain 'G':
    Compound: Hemoglobin alpha 2 chain
    Species: Gadus morhua [TaxId:8049]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hitg_
  • Chain 'H':
    Compound: Hemoglobin beta 4 chain
    Species: Gadus morhua [TaxId:8049]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3F9D7 (Start-144)
      • conflict (43)
      • conflict (55)
      • conflict (119)
    Domains in SCOPe 2.07: d6hith_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hitA (A:)
    slsskqkatvkdffskmstrsddigaealsrlvavypqtksyfshwkdaspgsapvrkhg
    itimggvydavgkiddlkggllslselhafmlrvdpvnfkllahcmlvcmsmifpeeftp
    qvhvavdkflaqlalalaekyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hitB (B:)
    vewtdseraiitsifsnldyeeigrkslcrclivypwtqryfgafgnlynaetilanpli
    aahgtkilhgldralknmddikntyaelsllhsdklhvdpdnfrlladcltvviaakmgs
    aftvdtqvawqkflsvvvsalgrqy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hitC (C:)
    slsskqkatvkdffskmstrsddigaealsrlvavypqtksyfshwkdaspgsapvrkhg
    itimggvydavgkiddlkggllslselhafmlrvdpvnfkllahcmlvcmsmifpeeftp
    qvhvavdkflaqlalalaekyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hitD (D:)
    vewtdseraiitsifsnldyeeigrkslcrclivypwtqryfgafgnlynaetilanpli
    aahgtkilhgldralknmddikntyaelsllhsdklhvdpdnfrlladcltvviaakmgs
    aftvdtqvawqkflsvvvsalgrqy
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hitE (E:)
    slsskqkatvkdffskmstrsddigaealsrlvavypqtksyfshwkdaspgsapvrkhg
    itimggvydavgkiddlkggllslselhafmlrvdpvnfkllahcmlvcmsmifpeeftp
    qvhvavdkflaqlalalaekyr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hitF (F:)
    vewtdseraiitsifsnldyeeigrkslcrclivypwtqryfgafgnlynaetilanpli
    aahgtkilhgldralknmddikntyaelsllhsdklhvdpdnfrlladcltvviaakmgs
    aftvdtqvawqkflsvvvsalgrqy
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hitG (G:)
    slsskqkatvkdffskmstrsddigaealsrlvavypqtksyfshwkdaspgsapvrkhg
    itimggvydavgkiddlkggllslselhafmlrvdpvnfkllahcmlvcmsmifpeeftp
    qvhvavdkflaqlalalaekyr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6hitH (H:)
    vewtdseraiitsifsnldyeeigrkslcrclivypwtqryfgafgnlynaetilanpli
    aahgtkilhgldralknmddikntyaelsllhsdklhvdpdnfrlladcltvviaakmgs
    aftvdtqvawqkflsvvvsalgrqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hitH (H:)
    ewtdseraiitsifsnldyeeigrkslcrclivypwtqryfgafgnlynaetilanplia
    ahgtkilhgldralknmddikntyaelsllhsdklhvdpdnfrlladcltvviaakmgsa
    ftvdtqvawqkflsvvvsalgrqy