PDB entry 6hip
View 6hip on RCSB PDB site
Description: structure of spf45 uhm bound to hiv-1 rev ulm
Deposited on
2018-08-30, released
2019-03-27
The last revision was dated
2019-10-09, with a file datestamp of
2019-10-04.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Splicing factor 45
Species: Homo sapiens [TaxId:9606]
Gene: RBM17, SPF45
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Splicing factor 45
Species: Homo sapiens [TaxId:9606]
Gene: RBM17, SPF45
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: HIV-1 Rev (41-49)
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Heterogens: TRP, NA, HOH
PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.
- Chain 'A':
Sequence; same for both SEQRES and ATOM records:
>6hipA (A:)
amgkcptkvvllrnmvgagevdedlevetkeecekygkvgkcvifeipgapddeavrifl
efervesaikavvdlngryfggrvvkacfynldkfrvldlaeqv
- Chain 'B':
Sequence; same for both SEQRES and ATOM records:
>6hipB (B:)
amgkcptkvvllrnmvgagevdedlevetkeecekygkvgkcvifeipgapddeavrifl
efervesaikavvdlngryfggrvvkacfynldkfrvldlaeqv
- Chain 'C':
Sequence; same for both SEQRES and ATOM records:
>6hipC (C:)
rrrrwrerq