PDB entry 6hig

View 6hig on RCSB PDB site
Description: hPD-1/NBO1a Fab complex
Class: immune system
Keywords: Non-blocking antibody, PD-1/PD-L1 pathway, anti-PD-1 antibody, tumor clearance, IMMUNE SYSTEM
Deposited on 2018-08-29, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Programmed cell death protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Pdcd1, Pd1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15116 (0-End)
      • engineered mutation (60)
  • Chain 'H':
    Compound: heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HIG (0-End)
  • Chain 'L':
    Compound: light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HIG
    Domains in SCOPe 2.07: d6higl1, d6higl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6higL (L:)
    diqmtqspssvsasvgdrvtitcsasqgisgdlnwyqqkpgkapklliyhtsslhsgvps
    rfsgsgsgtdftltisslqpedfatyycqyyskdlltfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6higL (L:)
    iqmtqspssvsasvgdrvtitcsasqdlnwyqqkpgkapklliyhtsslhsgvpsrfsgs
    gsgtdftltisslqpedfatyycqyylltfgggtkleikrtvaapsvfifppsdeqlksg
    tasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyek
    hkvyacevthqglsspvtksfnr