PDB entry 6hi5

View 6hi5 on RCSB PDB site
Description: the atad2 bromodomain in complex with compound 8
Deposited on 2018-08-29, released 2019-02-20
The last revision was dated 2020-11-04, with a file datestamp of 2020-10-30.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATPase family AAA domain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PL18 (2-129)
      • expression tag (0-1)
  • Heterogens: SO4, G6E, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hi5A (A:)
smqeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviski
dlhkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfe
qlceeiqesr

    Sequence, based on observed residues (ATOM records):
    >6hi5A (A:)
smqeedtfrelriflrnvthrlaidkrfrvftkpvevpdyvtvikqpmdlssviskidlh
kyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfeqlc
eeiqesr