PDB entry 6hhe

View 6hhe on RCSB PDB site
Description: Crystal structure of the medfly Odorant Binding Protein CcapOBP22/CcapOBP69a
Class: transport protein
Keywords: Odorant Binding Proteins, OBP, pheromone, insect olfaction, TRANSPORT PROTEIN
Deposited on 2018-08-28, released 2018-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Odorant binding protein OBP69a
    Species: Ceratitis capitata [TaxId:7213]
    Gene: OBP69a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hhea_
  • Heterogens: SO4, PG0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hheA (A:)
    levpkhmrsgakkltnlciketgvtedlfieaqetgkmpnnqrlkcfihcvldkiglida
    dnivhldnlleilppefvpiveelhttcgtqsgadgcetaflttecyiktnpvilkllft
    tfse
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hheA (A:)
    sgakkltnlciketgvtedlfieaqetgkmpnnqrlkcfihcvldkiglidadnivhldn
    lleilppefvpiveelhttcgtqsgadgcetaflttecyiktnpvilkllfttfse