PDB entry 6hhd

View 6hhd on RCSB PDB site
Description: Mouse Prion Protein in complex with Nanobody 484
Class: protein binding
Keywords: Prion, Nanobody, aggregation, B-sheet, PROTEIN BINDING
Deposited on 2018-08-28, released 2019-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: Prnp, Prn-p, Prp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hhda_
  • Chain 'B':
    Compound: Nanobody 484
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HHD (0-123)
    Domains in SCOPe 2.08: d6hhdb1, d6hhdb2
  • Chain 'C':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: Prnp, Prn-p, Prp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hhdc_
  • Chain 'D':
    Compound: Nanobody 484
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HHD (0-124)
    Domains in SCOPe 2.08: d6hhdd1, d6hhdd2
  • Heterogens: CL, SO4, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hhdA (A:)
gavvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hhdB (B:)
qvqlqesggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdy
tdsvkgrftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqv
tvss

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hhdC (C:)
gavvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqay

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hhdD (D:)
qvqlqesggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdy
tdsvkgrftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqv
tvssh