PDB entry 6hh1

View 6hh1 on RCSB PDB site
Description: Structure of c-Kit with allosteric inhibitor 3G8
Class: transferase
Keywords: c-Kit, kinase, allosteric, inhibitor, TRANSFERASE
Deposited on 2018-08-24, released 2019-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mast/stem cell growth factor receptor Kit,Mast/stem cell growth factor receptor Kit
    Species: Homo sapiens [TaxId:9606]
    Gene: KIT, SCFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10721 (0-137)
      • conflict (129-133)
      • conflict (135)
      • linker (138-174)
    • Uniprot P10721 (175-302)
    Domains in SCOPe 2.08: d6hh1a_
  • Heterogens: PO4, G4E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hh1A (A:)
gnnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliksdaamtvavkm
lkpsahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnflrr
krdsficsktspaielaldledllsfsyqvakgmaflaskncihrdlaarnillthgrit
kicdfglardikndsnyvvkgnarlpvkwmapesifncvytfesdvwsygiflwelfslg
sspypgmpvdskfykmikegfrmlspehapaemydimktcwdadplkrptfkqivqliek
qis