PDB entry 6hgs

View 6hgs on RCSB PDB site
Description: Crystal Structure of Human APRT wild type in complex with GMP
Class: transferase
Keywords: Rossman fold, transferase
Deposited on 2018-08-23, released 2019-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hgsa_
  • Chain 'B':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hgsb_
  • Heterogens: 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hgsA (A:)
    dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
    gldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqr
    vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hgsA (A:)
    dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
    gldsrgflfgpslaqelglgcvlirkrgklpgptlwasyslgkaeleiqkdalepgqrvv
    vvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hgsB (B:)
    dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
    gldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqr
    vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hgsB (B:)
    dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
    gldsrgflfgpslaqelglgcvlirkrgklpgptlwasykaeleiqkdalepgqrvvvvd
    dllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye